Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
published on Tuesday, Apr 21, 2026 by ciscodevnet
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
published on Tuesday, Apr 21, 2026 by ciscodevnet
Object to capture the SNMP Trap Fwd Server details in APIC.
Using getNiatelemetryApicSnmpTrapFwdServerDetails
Two invocation forms are available. The direct form accepts plain arguments and either blocks until the result value is available, or returns a Promise-wrapped result. The output form accepts Input-wrapped arguments and returns an Output-wrapped result.
function getNiatelemetryApicSnmpTrapFwdServerDetails(args: GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs, opts?: InvokeOptions): Promise<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult>
function getNiatelemetryApicSnmpTrapFwdServerDetailsOutput(args: GetNiatelemetryApicSnmpTrapFwdServerDetailsOutputArgs, opts?: InvokeOptions): Output<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult>def get_niatelemetry_apic_snmp_trap_fwd_server_details(account_moid: Optional[str] = None,
additional_properties: Optional[str] = None,
address: Optional[str] = None,
ancestors: Optional[Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor]] = None,
class_id: Optional[str] = None,
create_time: Optional[str] = None,
dn: Optional[str] = None,
domain_group_moid: Optional[str] = None,
id: Optional[str] = None,
mod_time: Optional[str] = None,
moid: Optional[str] = None,
object_type: Optional[str] = None,
owners: Optional[Sequence[str]] = None,
parent: Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsParent] = None,
permission_resources: Optional[Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource]] = None,
pol_dn: Optional[str] = None,
record_type: Optional[str] = None,
record_version: Optional[str] = None,
registered_device: Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice] = None,
shared_scope: Optional[str] = None,
site_name: Optional[str] = None,
tags: Optional[Sequence[GetNiatelemetryApicSnmpTrapFwdServerDetailsTag]] = None,
version_context: Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext] = None,
opts: Optional[InvokeOptions] = None) -> GetNiatelemetryApicSnmpTrapFwdServerDetailsResult
def get_niatelemetry_apic_snmp_trap_fwd_server_details_output(account_moid: pulumi.Input[Optional[str]] = None,
additional_properties: pulumi.Input[Optional[str]] = None,
address: pulumi.Input[Optional[str]] = None,
ancestors: pulumi.Input[Optional[Sequence[pulumi.Input[GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestorArgs]]]] = None,
class_id: pulumi.Input[Optional[str]] = None,
create_time: pulumi.Input[Optional[str]] = None,
dn: pulumi.Input[Optional[str]] = None,
domain_group_moid: pulumi.Input[Optional[str]] = None,
id: pulumi.Input[Optional[str]] = None,
mod_time: pulumi.Input[Optional[str]] = None,
moid: pulumi.Input[Optional[str]] = None,
object_type: pulumi.Input[Optional[str]] = None,
owners: pulumi.Input[Optional[Sequence[pulumi.Input[str]]]] = None,
parent: pulumi.Input[Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsParentArgs]] = None,
permission_resources: pulumi.Input[Optional[Sequence[pulumi.Input[GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResourceArgs]]]] = None,
pol_dn: pulumi.Input[Optional[str]] = None,
record_type: pulumi.Input[Optional[str]] = None,
record_version: pulumi.Input[Optional[str]] = None,
registered_device: pulumi.Input[Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDeviceArgs]] = None,
shared_scope: pulumi.Input[Optional[str]] = None,
site_name: pulumi.Input[Optional[str]] = None,
tags: pulumi.Input[Optional[Sequence[pulumi.Input[GetNiatelemetryApicSnmpTrapFwdServerDetailsTagArgs]]]] = None,
version_context: pulumi.Input[Optional[GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextArgs]] = None,
opts: Optional[InvokeOptions] = None) -> Output[GetNiatelemetryApicSnmpTrapFwdServerDetailsResult]func LookupNiatelemetryApicSnmpTrapFwdServerDetails(ctx *Context, args *LookupNiatelemetryApicSnmpTrapFwdServerDetailsArgs, opts ...InvokeOption) (*LookupNiatelemetryApicSnmpTrapFwdServerDetailsResult, error)
func LookupNiatelemetryApicSnmpTrapFwdServerDetailsOutput(ctx *Context, args *LookupNiatelemetryApicSnmpTrapFwdServerDetailsOutputArgs, opts ...InvokeOption) LookupNiatelemetryApicSnmpTrapFwdServerDetailsResultOutput> Note: This function is named LookupNiatelemetryApicSnmpTrapFwdServerDetails in the Go SDK.
public static class GetNiatelemetryApicSnmpTrapFwdServerDetails
{
public static Task<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> InvokeAsync(GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs args, InvokeOptions? opts = null)
public static Output<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> Invoke(GetNiatelemetryApicSnmpTrapFwdServerDetailsInvokeArgs args, InvokeOptions? opts = null)
}public static CompletableFuture<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> getNiatelemetryApicSnmpTrapFwdServerDetails(GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs args, InvokeOptions options)
public static Output<GetNiatelemetryApicSnmpTrapFwdServerDetailsResult> getNiatelemetryApicSnmpTrapFwdServerDetails(GetNiatelemetryApicSnmpTrapFwdServerDetailsArgs args, InvokeOptions options)
fn::invoke:
function: intersight:index/getNiatelemetryApicSnmpTrapFwdServerDetails:getNiatelemetryApicSnmpTrapFwdServerDetails
arguments:
# arguments dictionarydata "intersight_getniatelemetryapicsnmptrapfwdserverdetails" "name" {
# arguments
}The following arguments are supported:
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Address string
- Address of SNMP Trap Fwd Server in APIC.
- Ancestors
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor> - Class
Id string - Create
Time string - The time when this managed object was created.
- Dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Id string
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Owners List<string>
- Parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - Permission
Resources List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource> - Pol
Dn string - Dn of the parent SNMP Policy in APIC.
- Record
Type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- Record
Version string - Version of record being pushed. This determines what was the API version for data available from the device.
- Registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- Site
Name string - Name of the APIC site from which this data is being collected.
-
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag> - Version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Address string
- Address of SNMP Trap Fwd Server in APIC.
- Ancestors
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor - Class
Id string - Create
Time string - The time when this managed object was created.
- Dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Id string
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Owners []string
- Parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - Permission
Resources []GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource - Pol
Dn string - Dn of the parent SNMP Policy in APIC.
- Record
Type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- Record
Version string - Version of record being pushed. This determines what was the API version for data available from the device.
- Registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- Site
Name string - Name of the APIC site from which this data is being collected.
-
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag - Version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- account_
moid string - The Account ID for this managed object.
- additional_
properties string - address string
- Address of SNMP Trap Fwd Server in APIC.
- ancestors list(object)
- class_
id string - create_
time string - The time when this managed object was created.
- dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain_
group_ stringmoid - The DomainGroup ID for this managed object.
- id string
- mod_
time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - owners list(string)
- parent object
- permission_
resources list(object) - pol_
dn string - Dn of the parent SNMP Policy in APIC.
- record_
type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record_
version string - Version of record being pushed. This determines what was the API version for data available from the device.
- registered_
device object - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site_
name string - Name of the APIC site from which this data is being collected.
- list(object)
- version_
context object
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - address String
- Address of SNMP Trap Fwd Server in APIC.
- ancestors
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor> - class
Id String - create
Time String - The time when this managed object was created.
- dn String
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- id String
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - owners List<String>
- parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - permission
Resources List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource> - pol
Dn String - Dn of the parent SNMP Policy in APIC.
- record
Type String - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record
Version String - Version of record being pushed. This determines what was the API version for data available from the device.
- registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site
Name String - Name of the APIC site from which this data is being collected.
-
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag> - version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- account
Moid string - The Account ID for this managed object.
- additional
Properties string - address string
- Address of SNMP Trap Fwd Server in APIC.
- ancestors
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor[] - class
Id string - create
Time string - The time when this managed object was created.
- dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain
Group stringMoid - The DomainGroup ID for this managed object.
- id string
- mod
Time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - owners string[]
- parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - permission
Resources GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource[] - pol
Dn string - Dn of the parent SNMP Policy in APIC.
- record
Type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record
Version string - Version of record being pushed. This determines what was the API version for data available from the device.
- registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site
Name string - Name of the APIC site from which this data is being collected.
-
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag[] - version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- account_
moid str - The Account ID for this managed object.
- additional_
properties str - address str
- Address of SNMP Trap Fwd Server in APIC.
- ancestors
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor] - class_
id str - create_
time str - The time when this managed object was created.
- dn str
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain_
group_ strmoid - The DomainGroup ID for this managed object.
- id str
- mod_
time str - The time when this managed object was last modified.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - owners Sequence[str]
- parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - permission_
resources Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource] - pol_
dn str - Dn of the parent SNMP Policy in APIC.
- record_
type str - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record_
version str - Version of record being pushed. This determines what was the API version for data available from the device.
- registered_
device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - str
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site_
name str - Name of the APIC site from which this data is being collected.
-
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag] - version_
context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - address String
- Address of SNMP Trap Fwd Server in APIC.
- ancestors List<Property Map>
- class
Id String - create
Time String - The time when this managed object was created.
- dn String
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- id String
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - owners List<String>
- parent Property Map
- permission
Resources List<Property Map> - pol
Dn String - Dn of the parent SNMP Policy in APIC.
- record
Type String - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record
Version String - Version of record being pushed. This determines what was the API version for data available from the device.
- registered
Device Property Map - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site
Name String - Name of the APIC site from which this data is being collected.
- List<Property Map>
- version
Context Property Map
getNiatelemetryApicSnmpTrapFwdServerDetails Result
The following output properties are available:
- Id string
- Results
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result> - Account
Moid string - Additional
Properties string - Address string
- Ancestors
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor> - Class
Id string - Create
Time string - Dn string
- Domain
Group stringMoid - Mod
Time string - Moid string
- Object
Type string - Owners List<string>
- Parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - Permission
Resources List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource> - Pol
Dn string - Record
Type string - Record
Version string - Registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - string
- Site
Name string -
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag> - Version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- Id string
- Results
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result - Account
Moid string - Additional
Properties string - Address string
- Ancestors
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor - Class
Id string - Create
Time string - Dn string
- Domain
Group stringMoid - Mod
Time string - Moid string
- Object
Type string - Owners []string
- Parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - Permission
Resources []GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource - Pol
Dn string - Record
Type string - Record
Version string - Registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - string
- Site
Name string -
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag - Version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- id string
- results list(object)
- account_
moid string - additional_
properties string - address string
- ancestors list(object)
- class_
id string - create_
time string - dn string
- domain_
group_ stringmoid - mod_
time string - moid string
- object_
type string - owners list(string)
- parent object
- permission_
resources list(object) - pol_
dn string - record_
type string - record_
version string - registered_
device object - string
- site_
name string - list(object)
- version_
context object
- id String
- results
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result> - account
Moid String - additional
Properties String - address String
- ancestors
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor> - class
Id String - create
Time String - dn String
- domain
Group StringMoid - mod
Time String - moid String
- object
Type String - owners List<String>
- parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - permission
Resources List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource> - pol
Dn String - record
Type String - record
Version String - registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - String
- site
Name String -
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag> - version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- id string
- results
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result[] - account
Moid string - additional
Properties string - address string
- ancestors
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor[] - class
Id string - create
Time string - dn string
- domain
Group stringMoid - mod
Time string - moid string
- object
Type string - owners string[]
- parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - permission
Resources GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource[] - pol
Dn string - record
Type string - record
Version string - registered
Device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - string
- site
Name string -
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag[] - version
Context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- id str
- results
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result] - account_
moid str - additional_
properties str - address str
- ancestors
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Ancestor] - class_
id str - create_
time str - dn str
- domain_
group_ strmoid - mod_
time str - moid str
- object_
type str - owners Sequence[str]
- parent
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Parent - permission_
resources Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Permission Resource] - pol_
dn str - record_
type str - record_
version str - registered_
device GetNiatelemetry Apic Snmp Trap Fwd Server Details Registered Device - str
- site_
name str -
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag] - version_
context GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context
- id String
- results List<Property Map>
- account
Moid String - additional
Properties String - address String
- ancestors List<Property Map>
- class
Id String - create
Time String - dn String
- domain
Group StringMoid - mod
Time String - moid String
- object
Type String - owners List<String>
- parent Property Map
- permission
Resources List<Property Map> - pol
Dn String - record
Type String - record
Version String - registered
Device Property Map - String
- site
Name String - List<Property Map>
- version
Context Property Map
Supporting Types
GetNiatelemetryApicSnmpTrapFwdServerDetailsAncestor
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsParent
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsPermissionResource
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsRegisteredDevice
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsResult
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Address string
- Address of SNMP Trap Fwd Server in APIC.
- Ancestors
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Ancestor> - Class
Id string - Create
Time string - The time when this managed object was created.
- Dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Owners List<string>
- Parents
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Parent> - Permission
Resources List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Permission Resource> - Pol
Dn string - Dn of the parent SNMP Policy in APIC.
- Record
Type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- Record
Version string - Version of record being pushed. This determines what was the API version for data available from the device.
- Registered
Devices List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Registered Device> - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- Site
Name string - Name of the APIC site from which this data is being collected.
-
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Tag> - Version
Contexts List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context>
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Address string
- Address of SNMP Trap Fwd Server in APIC.
- Ancestors
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Ancestor - Class
Id string - Create
Time string - The time when this managed object was created.
- Dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Owners []string
- Parents
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Parent - Permission
Resources []GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Permission Resource - Pol
Dn string - Dn of the parent SNMP Policy in APIC.
- Record
Type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- Record
Version string - Version of record being pushed. This determines what was the API version for data available from the device.
- Registered
Devices []GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Registered Device - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- Site
Name string - Name of the APIC site from which this data is being collected.
-
[]Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Tag - Version
Contexts []GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context
- account_
moid string - The Account ID for this managed object.
- additional_
properties string - address string
- Address of SNMP Trap Fwd Server in APIC.
- ancestors list(object)
- class_
id string - create_
time string - The time when this managed object was created.
- dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain_
group_ stringmoid - The DomainGroup ID for this managed object.
- mod_
time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - owners list(string)
- parents list(object)
- permission_
resources list(object) - pol_
dn string - Dn of the parent SNMP Policy in APIC.
- record_
type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record_
version string - Version of record being pushed. This determines what was the API version for data available from the device.
- registered_
devices list(object) - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site_
name string - Name of the APIC site from which this data is being collected.
- list(object)
- version_
contexts list(object)
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - address String
- Address of SNMP Trap Fwd Server in APIC.
- ancestors
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Ancestor> - class
Id String - create
Time String - The time when this managed object was created.
- dn String
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - owners List<String>
- parents
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Parent> - permission
Resources List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Permission Resource> - pol
Dn String - Dn of the parent SNMP Policy in APIC.
- record
Type String - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record
Version String - Version of record being pushed. This determines what was the API version for data available from the device.
- registered
Devices List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Registered Device> - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site
Name String - Name of the APIC site from which this data is being collected.
-
List<Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Tag> - version
Contexts List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context>
- account
Moid string - The Account ID for this managed object.
- additional
Properties string - address string
- Address of SNMP Trap Fwd Server in APIC.
- ancestors
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Ancestor[] - class
Id string - create
Time string - The time when this managed object was created.
- dn string
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain
Group stringMoid - The DomainGroup ID for this managed object.
- mod
Time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - owners string[]
- parents
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Parent[] - permission
Resources GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Permission Resource[] - pol
Dn string - Dn of the parent SNMP Policy in APIC.
- record
Type string - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record
Version string - Version of record being pushed. This determines what was the API version for data available from the device.
- registered
Devices GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Registered Device[] - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site
Name string - Name of the APIC site from which this data is being collected.
-
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Tag[] - version
Contexts GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context[]
- account_
moid str - The Account ID for this managed object.
- additional_
properties str - address str
- Address of SNMP Trap Fwd Server in APIC.
- ancestors
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Ancestor] - class_
id str - create_
time str - The time when this managed object was created.
- dn str
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain_
group_ strmoid - The DomainGroup ID for this managed object.
- mod_
time str - The time when this managed object was last modified.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - owners Sequence[str]
- parents
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Parent] - permission_
resources Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Permission Resource] - pol_
dn str - Dn of the parent SNMP Policy in APIC.
- record_
type str - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record_
version str - Version of record being pushed. This determines what was the API version for data available from the device.
- registered_
devices Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Registered Device] - str
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site_
name str - Name of the APIC site from which this data is being collected.
-
Sequence[Get
Niatelemetry Apic Snmp Trap Fwd Server Details Result Tag] - version_
contexts Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context]
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - address String
- Address of SNMP Trap Fwd Server in APIC.
- ancestors List<Property Map>
- class
Id String - create
Time String - The time when this managed object was created.
- dn String
- Dn of the SNMP Trap Fwd Server details in APIC.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - owners List<String>
- parents List<Property Map>
- permission
Resources List<Property Map> - pol
Dn String - Dn of the parent SNMP Policy in APIC.
- record
Type String - Type of record DCNM / APIC / SE. This determines the type of platform where inventory was collected.
- record
Version String - Version of record being pushed. This determines what was the API version for data available from the device.
- registered
Devices List<Property Map> - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- site
Name String - Name of the APIC site from which this data is being collected.
- List<Property Map>
- version
Contexts List<Property Map>
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultAncestor
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultParent
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultPermissionResource
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultRegisteredDevice
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTag
- additional_
properties string - ancestor_
definitions list(object) - definitions list(object)
- key string
- propagated bool
- sys_
tag bool - type string
- value string
- additional
Properties String - ancestor
Definitions List<Property Map> - definitions List<Property Map>
- key String
- propagated Boolean
- sys
Tag Boolean - type String
- value String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTagAncestorDefinition
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultTagDefinition
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContext
- Additional
Properties string - Class
Id string - Interested
Mos List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Interested Mo> - Marked
For boolDeletion - Nr
Version string - Object
Type string - Ref
Mos List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Ref Mo> - Timestamp string
- Version
Type string
- additional_
properties string - class_
id string - interested_
mos list(object) - marked_
for_ booldeletion - nr_
version string - object_
type string - ref_
mos list(object) - timestamp string
- version_
type string
- additional
Properties String - class
Id String - interested
Mos List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Interested Mo> - marked
For BooleanDeletion - nr
Version String - object
Type String - ref
Mos List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Ref Mo> - timestamp String
- version
Type String
- additional
Properties string - class
Id string - interested
Mos GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Interested Mo[] - marked
For booleanDeletion - nr
Version string - object
Type string - ref
Mos GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Ref Mo[] - timestamp string
- version
Type string
- additional_
properties str - class_
id str - interested_
mos Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Interested Mo] - marked_
for_ booldeletion - nr_
version str - object_
type str - ref_
mos Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Result Version Context Ref Mo] - timestamp str
- version_
type str
- additional
Properties String - class
Id String - interested
Mos List<Property Map> - marked
For BooleanDeletion - nr
Version String - object
Type String - ref
Mos List<Property Map> - timestamp String
- version
Type String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContextInterestedMo
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsResultVersionContextRefMo
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetNiatelemetryApicSnmpTrapFwdServerDetailsTag
- Additional
Properties string - Ancestor
Definitions List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Tag Ancestor Definition> - Definition
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- Key string
- The string representation of a tag key.
- Propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- Sys
Tag bool - Specifies whether the tag is user-defined or owned by the system.
- Type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- Value string
- The string representation of a tag value.
- Additional
Properties string - Ancestor
Definitions []GetNiatelemetry Apic Snmp Trap Fwd Server Details Tag Ancestor Definition - Definition
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- Key string
- The string representation of a tag key.
- Propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- Sys
Tag bool - Specifies whether the tag is user-defined or owned by the system.
- Type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- Value string
- The string representation of a tag value.
- additional_
properties string - ancestor_
definitions list(object) - definition object
- The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key string
- The string representation of a tag key.
- propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys_
tag bool - Specifies whether the tag is user-defined or owned by the system.
- type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value string
- The string representation of a tag value.
- additional
Properties String - ancestor
Definitions List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Tag Ancestor Definition> - definition
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key String
- The string representation of a tag key.
- propagated Boolean
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys
Tag Boolean - Specifies whether the tag is user-defined or owned by the system.
- type String
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value String
- The string representation of a tag value.
- additional
Properties string - ancestor
Definitions GetNiatelemetry Apic Snmp Trap Fwd Server Details Tag Ancestor Definition[] - definition
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key string
- The string representation of a tag key.
- propagated boolean
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys
Tag boolean - Specifies whether the tag is user-defined or owned by the system.
- type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value string
- The string representation of a tag value.
- additional_
properties str - ancestor_
definitions Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Tag Ancestor Definition] - definition
Get
Niatelemetry Apic Snmp Trap Fwd Server Details Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key str
- The string representation of a tag key.
- propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys_
tag bool - Specifies whether the tag is user-defined or owned by the system.
- type str
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value str
- The string representation of a tag value.
- additional
Properties String - ancestor
Definitions List<Property Map> - definition Property Map
- The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key String
- The string representation of a tag key.
- propagated Boolean
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys
Tag Boolean - Specifies whether the tag is user-defined or owned by the system.
- type String
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value String
- The string representation of a tag value.
GetNiatelemetryApicSnmpTrapFwdServerDetailsTagAncestorDefinition
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsTagDefinition
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContext
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Interested
Mos List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Interested Mo> - Marked
For boolDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- Nr
Version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- Object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- Ref
Mo GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Ref Mo - A reference to the original Managed Object.
- Timestamp string
- The time this versioned Managed Object was created.
- Version
Type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Interested
Mos []GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Interested Mo - Marked
For boolDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- Nr
Version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- Object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- Ref
Mo GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Ref Mo - A reference to the original Managed Object.
- Timestamp string
- The time this versioned Managed Object was created.
- Version
Type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested_
mos list(object) - marked_
for_ booldeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr_
version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object_
type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref_
mo object - A reference to the original Managed Object.
- timestamp string
- The time this versioned Managed Object was created.
- version_
type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested
Mos List<GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Interested Mo> - marked
For BooleanDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr
Version String - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object
Type String - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref
Mo GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Ref Mo - A reference to the original Managed Object.
- timestamp String
- The time this versioned Managed Object was created.
- version
Type String - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested
Mos GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Interested Mo[] - marked
For booleanDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr
Version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref
Mo GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Ref Mo - A reference to the original Managed Object.
- timestamp string
- The time this versioned Managed Object was created.
- version
Type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested_
mos Sequence[GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Interested Mo] - marked_
for_ booldeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr_
version str - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object_
type str - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref_
mo GetNiatelemetry Apic Snmp Trap Fwd Server Details Version Context Ref Mo - A reference to the original Managed Object.
- timestamp str
- The time this versioned Managed Object was created.
- version_
type str - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested
Mos List<Property Map> - marked
For BooleanDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr
Version String - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object
Type String - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref
Mo Property Map - A reference to the original Managed Object.
- timestamp String
- The time this versioned Managed Object was created.
- version
Type String - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextInterestedMo
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetNiatelemetryApicSnmpTrapFwdServerDetailsVersionContextRefMo
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
Package Details
- Repository
- intersight ciscodevnet/terraform-provider-intersight
- License
- Notes
- This Pulumi package is based on the
intersightTerraform Provider.
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
published on Tuesday, Apr 21, 2026 by ciscodevnet